Structure of PDB 5ibb Chain 2A

Receptor sequence
>5ibb2A (length=113) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQL
AALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTP
VPHNGCRPKKKFR
3D structure
PDB5ibb The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
Chain2A
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2A Y20 Y25 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 V47 K51 G52 S53 R54 K55 R85 P113 V114 H116 N117 G118 C119 R120 K123 Y7 Y12 N13 N14 I16 T18 G24 N25 P26 W29 S31 G33 V34 K38 G39 S40 R41 K42 R72 P100 V101 H103 N104 G105 C106 R107 K110
BS02 MG 2A N26 G52 N13 G39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ibb, PDBe:5ibb, PDBj:5ibb
PDBsum5ibb
PubMed27174928
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]