Structure of PDB 5el5 Chain 2A

Receptor sequence
>5el52A (length=113) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQL
AALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTP
VPHNGCRPKKKFR
3D structure
PDB5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Chain2A
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2A Y20 N26 N27 I29 T31 D36 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 P113 V114 P115 H116 N117 G118 C119 R120 K123 Y7 N13 N14 I16 T18 D23 G24 N25 P26 W29 S31 G33 G39 S40 K42 R72 P100 V101 P102 H103 N104 G105 C106 R107 K110
BS02 MG 2A N26 G52 N13 G39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5el5, PDBe:5el5, PDBj:5el5
PDBsum5el5
PubMed26791911
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]