Structure of PDB 8vtv Chain 29

Receptor sequence
>8vtv29 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Chain29
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 29 M1 K2 R4 A5 S6 V7 K8 R9 K15 V16 R18 R19 H20 R22 K31 K33 R35 Q36 G37 M1 K2 R4 A5 S6 V7 K8 R9 K15 V16 R18 R19 H20 R22 K31 K33 R35 Q36 G37
BS02 MG 29 M1 V3 M1 V3
BS03 ZN 29 C11 C27 H32 C11 C27 H32
External links
PDB RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum8vtv
PubMed39039256
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]