Structure of PDB 8ud7 Chain 29

Receptor sequence
>8ud729 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB8ud7 An antibiotic preorganized for ribosomal binding overcomes antimicrobial resistance
Chain29
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 29 M1 K2 V3 R4 A5 S6 V7 R9 K15 V16 R19 H20 R22 Y24 P30 K31 K33 R35 Q36 M1 K2 V3 R4 A5 S6 V7 R9 K15 V16 R19 H20 R22 Y24 P30 K31 K33 R35 Q36
BS02 ZN 29 C11 C27 H32 C11 C27 H32
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ud7, PDBe:8ud7, PDBj:8ud7
PDBsum8ud7
PubMed38359125
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]