Structure of PDB 6xqd Chain 29

Receptor sequence

>6xqd29 (length=37) Species: 300852 (Thermus thermophilus HB8)

MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG

3D structure

• PDB: 6xqd Sarecycline interferes with tRNA accommodation and tethers mRNA to the 70S ribosome.
• Chain: 29
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	29	M1 K2 R4 A5 S6 V7 K8 R9 I10 K15 V16 R18 R19 H20 R22 P30 K31 K33 R35 Q36 G37	M1 K2 R4 A5 S6 V7 K8 R9 I10 K15 V16 R18 R19 H20 R22 P30 K31 K33 R35 Q36 G37
BS02	MG	29	M1 V3	M1 V3
BS03	ZN	29	C11 C14 C27 H32	C11 C14 C27 H32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xqd, PDBe:6xqd, PDBj:6xqd
• PDBsum: 6xqd
• PubMed: 32817463
• UniProt: Q5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)