Structure of PDB 5el7 Chain 29

Receptor sequence

>5el729 (length=204) Species: 300852 (Thermus thermophilus HB8)

MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLG
FLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGE
RVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRV
YKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRE
TKKA

3D structure

• PDB: 5el7 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 29
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	29	K8 M11 T12 R13 Q35 R37 K41 D42 Y44 Q48 R58 N60 R61 P62 L63 K64 H66 I77 L78 R79 E80 R82 S108 K109 G110 R111 G112 F113 G115 K118 R119 F122 A123 D127 S128 H129 G130 A131 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 Y151 K152 K154 M156 A157 H159 Y160 R164 T166 M168 N169 K185 A187 V188 P189 G190 P191 A204	K8 M11 T12 R13 Q35 R37 K41 D42 Y44 Q48 R58 N60 R61 P62 L63 K64 H66 I77 L78 R79 E80 R82 S108 K109 G110 R111 G112 F113 G115 K118 R119 F122 A123 D127 S128 H129 G130 A131 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 Y151 K152 K154 M156 A157 H159 Y160 R164 T166 M168 N169 K185 A187 V188 P189 G190 P191 A204
BS02	MG	29	R119 N121 Y160	R119 N121 Y160

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el7, PDBe:5el7, PDBj:5el7
• PDBsum: 5el7
• PubMed: 26791911
• UniProt: Q5SHN8|RL3_THET8 Large ribosomal subunit protein uL3 (Gene Name=rplC)