Structure of PDB 4y4p Chain 29

Receptor sequence

>4y4p29 (length=37) Species: 300852 (Thermus thermophilus HB8)

MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG

3D structure

• PDB: 4y4p Structural insights into the role of rRNA modifications in protein synthesis and ribosome assembly.
• Chain: 29
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	29	M1 K2 V3 R4 A5 S6 V7 K8 R9 K15 V16 R18 R19 H20 P30 K31 K33 R35 Q36	M1 K2 V3 R4 A5 S6 V7 K8 R9 K15 V16 R18 R19 H20 P30 K31 K33 R35 Q36
BS02	MG	29	M1 V3	M1 V3
BS03	ZN	29	C11 C14 C27 H32	C11 C14 C27 H32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4y4p, PDBe:4y4p, PDBj:4y4p
• PDBsum: 4y4p
• PubMed: 25775268
• UniProt: Q5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)