Structure of PDB 9b00 Chain 28

Receptor sequence

>9b0028 (length=64) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE

3D structure

PDB

9b00 Berberine analog of chloramphenicol exhibits a distinct mode of action and unveils ribosome plasticity.

Chain

Resolution

2.8 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	28	P2 K3 M4 K5 T6 H7 K8 K12 R13 K15 T17 A18 S19 K26 T27 K29 R30 H31 L32 N33 W34 Q35 K39 I41 R42 Q43 K44 R46 K47 F48 A51 K52 Y64	P1 K2 M3 K4 T5 H6 K7 K11 R12 K14 T16 A17 S18 K25 T26 K28 R29 H30 L31 N32 W33 Q34 K38 I40 R41 Q42 K43 R45 K46 F47 A50 K51 Y63
BS02	MG	28	R42 Q43	R41 Q42

External links

PDB	RCSB:9b00, PDBe:9b00, PDBj:9b00
PDBsum	9b00
PubMed	39019034
UniProt	Q5SKU1\|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)