Structure of PDB 8vtw Chain 27

Receptor sequence

>8vtw27 (length=48) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK

3D structure

PDB

8vtw Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.

Chain

Resolution

2.35 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	27	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48
BS02	MG	27	W5 P7	W5 P7
BS03	MG	27	T4 W5	T4 W5
BS04	MG	27	K2 R3	K2 R3

External links

PDB	RCSB:8vtw, PDBe:8vtw, PDBj:8vtw
PDBsum	8vtw
PubMed	39039256
UniProt	P80340\|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)