Structure of PDB 8uvs Chain 27

Receptor sequence

>8uvs27 (length=48) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	27	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 K37 G38 R39 W40 R41 R47 K48	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 K37 G38 R39 W40 R41 R47 K48
BS02	MG	27	W5 P7	W5 P7

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	P80340\|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)