Structure of PDB 8fc6 Chain 27

Receptor sequence

>8fc627 (length=48) Species: 300852 (Thermus thermophilus HB8)

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK

3D structure

• PDB: 8fc6 Structural insights into the mechanism of overcoming Erm-mediated resistance by macrolides acting together with hygromycin-A.
• Chain: 27
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	27	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 K37 G38 R39 W40 R47 K48	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 H16 G17 F18 R19 R21 P25 G26 K29 K32 R33 R34 R35 K37 G38 R39 W40 R47 K48
BS02	MG	27	W5 P7	W5 P7
BS03	MG	27	T4 W5	T4 W5

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fc6, PDBe:8fc6, PDBj:8fc6
• PDBsum: 8fc6
• PubMed: 37452045
• UniProt: P80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)