Structure of PDB 7jql Chain 26

Receptor sequence

>7jql26 (length=53) Species: 300852 (Thermus thermophilus HB8)

ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI

3D structure

• PDB: 7jql Peptide Inhibitors of Bacterial Protein Synthesis with Broad Spectrum and SbmA-Independent Bactericidal Activity against Clinical Pathogens.
• Chain: 26
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	26	A2 R6 R18 R19 Y21 E24 K25 N26 N29 T30 L36 R37 K38 Y39 P41 W42 R44 H46 I54	A1 R5 R17 R18 Y20 E23 K24 N25 N28 T29 L35 R36 K37 Y38 P40 W41 R43 H45 I53
BS02	MG	26	R6 E24 K25	R5 E23 K24
BS03	ZN	26	C13 C16 C40 C43	C12 C15 C39 C42

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7jql, PDBe:7jql, PDBj:7jql
• PDBsum: 7jql
• PubMed: 32787108
• UniProt: P35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)