Structure of PDB 5kps Chain 26

Receptor sequence
>5kps26 (length=65) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
KRHAKKLARENARRT
3D structure
PDB5kps Ribosome•RelA structures reveal the mechanism of stringent response activation.
Chain26
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 26 R17 R20 Y37 E38 K45 K48 V52 A64 R65 R66 T67 R15 R18 Y35 E36 K43 K46 V50 A62 R63 R64 T65
BS02 rna 26 R20 R54 R18 R52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kps, PDBe:5kps, PDBj:5kps
PDBsum5kps
PubMed27434674
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]