Structure of PDB 8vtv Chain 25

Receptor sequence
>8vtv25 (length=59) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGY
YAGRKVLEV
3D structure
PDB8vtv Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
Chain25
Resolution2.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 25 A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R16 A18 R19 R20 S21 H22 H23 T29 H43 Y52 A53 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 A13 R15 A17 R18 R19 S20 H21 H22 T28 H42 Y51 A52
BS02 MG 25 D17 R20 D16 R19
BS03 ZN 25 C33 C36 C46 C49 C32 C35 C45 C48
External links
PDB RCSB:8vtv, PDBe:8vtv, PDBj:8vtv
PDBsum8vtv
PubMed39039256
UniProtP80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]