Structure of PDB 5v8i Chain 25

Receptor sequence
>5v8i25 (length=59) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
AKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGY
YAGRKVLEV
3D structure
PDB5v8i Structural robustness of the ribosome inferred from X-ray crystal structures of the 30S ribosomal subunit and the 70S ribosome lacking ribosomal protein uS17
Chain25
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 25 A2 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R16 A18 R19 R20 S21 H22 H23 I29 V31 P34 P42 H43 Y52 A53 A1 K2 H3 P4 V5 P6 K7 K8 K9 T10 S11 K12 A13 R15 A17 R18 R19 S20 H21 H22 I28 V30 P33 P41 H42 Y51 A52
BS02 MG 25 V31 P32 V30 P31
BS03 ZN 25 C33 C46 C49 C32 C45 C48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v8i, PDBe:5v8i, PDBj:5v8i
PDBsum5v8i
PubMed
UniProtP62652|RL32_THET2 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]