Structure of PDB 3j6y Chain 25

Receptor sequence
>3j6y25 (length=70) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
AQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGGSLARIALRHLEK
EGIIKPISKHSKQAIYTRAT
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain25
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 25 G72 S74 R77 H95 S96 G37 S39 R42 H60 S61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]