Structure of PDB 6czr Chain 24 |
>6czr24 (length=69) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRYGDSYRK |
|
PDB | 6czr Unifying the Aminohexopyranose- and Peptidyl-Nucleoside Antibiotics: Implications for Antibiotic Design |
Chain | 24 |
Resolution | 3.14 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
24 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|