Structure of PDB 3j6x Chain 24

Receptor sequence

>3j6x24 (length=134) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]

SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD

3D structure

PDB

3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.

Chain

Resolution

6.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	24	R8 T9 R10 K11 V12 A33 N34 V35 S36 K37 F58 G59 R61 T62 Q63 F64 Y89 R93 R105 Q106 K109 N113 K116 K117 F119 G120 T121 K123 R124 R131 R132 D135	R7 T8 R9 K10 V11 A32 N33 V34 S35 K36 F57 G58 R60 T61 Q62 F63 Y88 R92 R104 Q105 K108 N112 K115 K116 F118 G119 T120 K122 R123 R130 R131 D134

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum	3j6x
PubMed	24927574
UniProt	P0CX31\|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)