Structure of PDB 5hd1 Chain 23

Receptor sequence

>5hd123 (length=59) Species: 300852 (Thermus thermophilus HB8)

PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVA
HLVRVEVVE

3D structure

• PDB: 5hd1 Structures of proline-rich peptides bound to the ribosome reveal a common mechanism of protein synthesis inhibition.
• Chain: 23
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	23	K10 S11 I13 G14 Y15 P16 K17 D18 A21 K24 A25 R29 R30 L31 P41 A42 G45 N46 K49	K9 S10 I12 G13 Y14 P15 K16 D17 A20 K23 A24 R28 R29 L30 P40 A41 G44 N45 K48
BS02	rna	23	Y15 Q19 H52	Y14 Q18 H51
BS03	MG	23	K10 S11	K9 S10

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5hd1, PDBe:5hd1, PDBj:5hd1
• PDBsum: 5hd1
• PubMed: 26809677
• UniProt: Q5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)