Structure of PDB 6gsl Chain 22

Receptor sequence
>6gsl22 (length=195) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQN
PNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIG
GAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIF
3D structure
PDB6gsl Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
Chain22
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 22 G2 N3 K4 I5 K26 K27 R127 S154 G155 R156 E161 A163 R172 L175 H176 T177 L178 R179 R190 T192 Y193 G194 V195 L196 K199 G1 N2 K3 I4 K25 K26 R119 S146 G147 R148 E153 A155 R164 L167 H168 T169 L170 R171 R182 T184 Y185 G186 V187 L188 K191
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gsl, PDBe:6gsl, PDBj:6gsl
PDBsum6gsl
PubMed29931292
UniProtP80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]