Structure of PDB 5ibb Chain 22

Receptor sequence
>5ibb22 (length=195) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
NKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGL
ARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQNP
NLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGG
AEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFL
3D structure
PDB5ibb The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
Chain22
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 22 N3 K4 I5 F10 K26 S154 G155 R156 E161 A163 W167 R172 H176 T177 L178 R190 T192 Y193 G194 V195 K199 N1 K2 I3 F8 K24 S145 G146 R147 E152 A154 W158 R163 H167 T168 L169 R181 T183 Y184 G185 V186 K190
BS02 rna 22 R131 Q162 R164 R122 Q153 R155
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ibb, PDBe:5ibb, PDBj:5ibb
PDBsum5ibb
PubMed27174928
UniProtP80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]