Structure of PDB 5ib7 Chain 22

Receptor sequence

>5ib722 (length=195) Species: 300852 (Thermus thermophilus HB8)

NKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGL
ARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQNP
NLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGG
AEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFL

3D structure

• PDB: 5ib7 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
• Chain: 22
• Resolution: 2.99 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	22	N3 K4 I5 F10 K26 K27 R127 S154 R156 E161 A163 W167 G171 R172 P174 L175 H176 T177 L178 R179 R190 T192 Y193 G194 V195 L196 K199	N1 K2 I3 F8 K24 K25 R118 S145 R147 E152 A154 W158 G162 R163 P165 L166 H167 T168 L169 R170 R181 T183 Y184 G185 V186 L187 K190
BS02	rna	22	Q162 R164	Q153 R155

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ib7, PDBe:5ib7, PDBj:5ib7
• PDBsum: 5ib7
• PubMed: 27174928
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)