Structure of PDB 5el7 Chain 22

Receptor sequence

>5el722 (length=196) Species: 300852 (Thermus thermophilus HB8)

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIRVLREELAKLTGKNVALNVQEVQN
PNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIG
GAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFL

3D structure

• PDB: 5el7 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 22
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	22	G2 N3 K4 I5 F10 K26 K27 R127 S154 G155 R156 E161 Q162 A163 W167 R172 V173 P174 H176 T177 L178 R179 T192 Y193 G194 V195 L196 K199	G1 N2 K3 I4 F9 K25 K26 R119 S146 G147 R148 E153 Q154 A155 W159 R164 V165 P166 H168 T169 L170 R171 T184 Y185 G186 V187 L188 K191
BS02	rna	22	A160 Q162 R164	A152 Q154 R156

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el7, PDBe:5el7, PDBj:5el7
• PDBsum: 5el7
• PubMed: 26791911
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)