Structure of PDB 3j6y Chain 22

Receptor sequence
>3j6y22 (length=129) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
Chain22
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 22 T2 R3 S4 A8 N12 N16 K19 R28 S30 S31 K32 H56 R57 S58 K71 I75 S76 N80 K82 K88 T105 T106 S107 K119 H120 S122 G123 Y130 T1 R2 S3 A7 N11 N15 K18 R27 S29 S30 K31 H55 R56 S57 K70 I74 S75 N79 K81 K87 T104 T105 S106 K118 H119 S121 G122 Y129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)

[Back to BioLiP]