Structure of PDB 8uvs Chain 21

Receptor sequence

>8uvs21 (length=97) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.

Chain

Resolution

2.75 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	21	S2 K3 K10 R11 V14 A15 N16 Q19 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 G55 R61 A64 H66 K69 R76 G79 K81 K92	S1 K2 K9 R10 V13 A14 N15 Q18 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 G54 R60 A63 H65 K68 R75 G78 K80 K91
BS02	rna	21	K23 V30	K22 V29
BS03	MG	21	R20 K32 T34	R19 K31 T33

External links

PDB	RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
PDBsum	8uvs
PubMed	38165935
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)