Structure of PDB 8vty Chain 20

Receptor sequence

>8vty20 (length=77) Species: 300852 (Thermus thermophilus HB8)

GSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDF
TLFALVDGVVEFQDRGRLGRYVHVRPL

3D structure

• PDB: 8vty Macrolones target bacterial ribosomes and DNA gyrase and can evade resistance mechanisms.
• Chain: 20
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	20	S9 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 T58 F60 F69 R74 R77	S2 N5 R7 D8 S9 Q10 A11 K12 R13 K17 R18 Y19 E20 Q22 R25 A26 G27 N28 I29 R32 R34 G35 T36 R37 G47 R48 D49 F50 T51 F53 F62 R67 R70
BS02	rna	20	R72 G73 R74 L75	R65 G66 R67 L68

External links

• PDB: RCSB:8vty, PDBe:8vty, PDBj:8vty
• PDBsum: 8vty
• PubMed: 39039256
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)