Structure of PDB 8uvs Chain 20

Receptor sequence

>8uvs20 (length=83) Species: 300852 (Thermus thermophilus HB8)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPL

3D structure

• PDB: 8uvs Development of 2nd generation aminomethyl spectinomycins that overcome native efflux in Mycobacterium abscessus.
• Chain: 20
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	20	H3 K4 S9 T10 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 L62 F69 R74 R77	H2 K3 S8 T9 N11 R13 D14 S15 Q16 A17 K18 R19 K23 R24 Y25 E26 Q28 A32 G33 N34 I35 R38 R40 G41 T42 R43 G53 R54 D55 F56 L61 F68 R73 R76
BS02	rna	20	R72 R74	R71 R73

External links

• PDB: RCSB:8uvs, PDBe:8uvs, PDBj:8uvs
• PDBsum: 8uvs
• PubMed: 38165935
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)