Structure of PDB 5hcr Chain 20

Receptor sequence

>5hcr20 (length=75) Species: 300852 (Thermus thermophilus HB8)

TRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPL

3D structure

• PDB: 5hcr Structures of proline-rich peptides bound to the ribosome reveal a common mechanism of protein synthesis inhibition.
• Chain: 20
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	20	R11 N12 R14 D15 S16 Q17 K19 R20 K24 R25 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 T58 F60 L62 F69 R74 R77	R2 N3 R5 D6 S7 Q8 K10 R11 K15 R16 Y17 E18 Q20 A24 G25 N26 I27 R30 R32 G33 T34 R35 G45 R46 D47 F48 T49 F51 L53 F60 R65 R68
BS02	rna	20	R72 R74	R63 R65

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5hcr, PDBe:5hcr, PDBj:5hcr
• PDBsum: 5hcr
• PubMed: 26809677
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)