Structure of PDB 4z8c Chain 20

Receptor sequence
>4z8c20 (length=75) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPL
3D structure
PDB4z8c The mechanism of inhibition of protein synthesis by the proline-rich peptide oncocin.
Chain20
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 20 N12 R14 D15 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 L62 F69 R74 R77 N3 R5 D6 S7 Q8 A9 K10 R11 K15 R16 Y17 E18 Q20 A24 G25 N26 I27 R30 R32 G33 T34 G45 R46 D47 F48 F51 L53 F60 R65 R68
BS02 rna 20 R72 R74 R63 R65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4z8c, PDBe:4z8c, PDBj:4z8c
PDBsum4z8c
PubMed25984972
UniProtP60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]