Structure of PDB 9c4g Chain 2

Receptor sequence

>9c4g2 (length=67) Species: 1747 (Cutibacterium acnes) [Search protein sequence]

PKMKSHSGTKKRFKVTGSGKVTARKAGKRHLNEHKSSRVTRRLTGETVLS
KGEAAKVKKLLAGHPGR

3D structure

PDB

9c4g Mechanistic basis for the translation inhibition of Cutibacterium acnes by Clindamycin.

Chain

Resolution

2.53 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2	P2 K3 M4 K5 S6 H7 S8 K11 K12 R13 K15 T17 G18 S19 K21 R25 K26 A27 G28 K29 R30 H31 L32 N33 E34 H35 S37 S38 R39 R42 R43 L44 K52 K57 H65 R68	P1 K2 M3 K4 S5 H6 S7 K10 K11 R12 K14 T16 G17 S18 K20 R24 K25 A26 G27 K28 R29 H30 L31 N32 E33 H34 S36 S37 R38 R41 R42 L43 K51 K56 H64 R67

External links

PDB	RCSB:9c4g, PDBe:9c4g, PDBj:9c4g
PDBsum	9c4g
PubMed	39122144
UniProt	Q6A7V2\|RL35_CUTAK Large ribosomal subunit protein bL35 (Gene Name=rpmI)