Structure of PDB 8wi7 Chain 2

Receptor sequence
>8wi72 (length=64) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
GTTPGELRELTDDELKDKLRESKEELFNLRFQMATGQLSNNRRLRTVRQE
IARVYTVLRERELG
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chain2
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 R11 M36 N43 N44 R45 R51 R56 T59 R62 R8 M33 N40 N41 R42 R48 R53 T56 R59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0QSD9|RL29_MYCS2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]