Structure of PDB 8s1p Chain 2

Receptor sequence
>8s1p2 (length=44) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
Chain2
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 K2 R3 T4 F5 Q6 P7 N8 N9 R10 K11 R12 S13 K14 H16 G17 F18 R19 R21 M22 K25 N26 R33 R34 R35 R36 K37 G38 R39 K40 M1 K2 R3 T4 F5 Q6 P7 N8 N9 R10 K11 R12 S13 K14 H16 G17 F18 R19 R21 M22 K25 N26 R33 R34 R35 R36 K37 G38 R39 K40
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP05647|RL34_BACSU Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]