Structure of PDB 8qbt Chain 2

Receptor sequence
>8qbt2 (length=78) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQANKAARHKANLTAQINKLA
3D structure
PDB8qbt Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
Chain2
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 N3 I4 K5 K9 R10 Q13 S14 R18 H20 N21 S23 R24 R25 S26 M27 R29 T30 K33 K34 Y36 Q55 P56 R60 N70 K71 A73 R74 K76 A77 N78 T80 N1 I2 K3 K7 R8 Q11 S12 R16 H18 N19 S21 R22 R23 S24 M25 R27 T28 K31 K32 Y34 Q53 P54 R58 N61 K62 A64 R65 K67 A68 N69 T71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qbt, PDBe:8qbt, PDBj:8qbt
PDBsum8qbt
PubMed38503735
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]