Structure of PDB 8om2 Chain 2

Receptor sequence
>8om22 (length=102) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
STIPKPSDQVPDVDAFLNKIGRNCNELKDTFENNWNNLFQWDSKILKEKG
VNIQQRKYILKQVHNYRNNRPIHEIKLGKKSFFGGERKRKAFTAKWKAEN
KQ
3D structure
PDB8om2 METTL17 is an Fe-S cluster checkpoint for mitochondrial translation.
Chain2
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 R50 S71 K75 I81 Q82 R84 K85 H92 K104 G106 K107 K108 S109 F110 F111 G113 E114 R115 K118 A122 K123 E127 R22 S43 K47 I53 Q54 R56 K57 H64 K76 G78 K79 K80 S81 F82 F83 G85 E86 R87 K90 A94 K95 E99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8om2, PDBe:8om2, PDBj:8om2
PDBsum8om2
PubMed38199006
UniProtP38783|FYV4_YEAST Small ribosomal subunit protein mS41 (Gene Name=FYV4)

[Back to BioLiP]