Structure of PDB 8oj0 Chain 2

Receptor sequence
>8oj02 (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
FVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKL
IHIPINNIIVGG
3D structure
PDB8oj0 UFM1 E3 ligase promotes recycling of 60S ribosomal subunits from the ER
Chain2
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide 2 I65 G68 I59 G62
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008320 protein transmembrane transporter activity
GO:0043022 ribosome binding
Biological Process
GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0045047 protein targeting to ER
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0071261 Ssh1 translocon complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oj0, PDBe:8oj0, PDBj:8oj0
PDBsum8oj0
PubMed38383785
UniProtP60059|SC61G_HUMAN Protein transport protein Sec61 subunit gamma (Gene Name=SEC61G)

[Back to BioLiP]