Structure of PDB 8jcw Chain 2

Receptor sequence
>8jcw2 (length=762) Species: 9606 (Homo sapiens) [Search protein sequence]
KVLTLEGDLVLGGLFPVHQKGGPAEDCGPVNEHRGIQRLEAMLFALDRIN
RDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRDAPTAITGVIG
GSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFFQ
AKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEKV
GRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTW
VASDGWGALESVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSR
NPWFREFWEQRFRCSFRQRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHA
LHNMHRALCPNTTRLCDAMRPVNGRRLYKDFVLNVKFDAPFRPADTHNEV
RFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPS
AGPLPASRCSEPCLQNEVKSVQPGEVCCWLCIPCQPYEYRLDEFTCADCG
LGYWPNASLTGCFELPQEYIRWGDAWAVGPVTIACLGALATLFVLGVFVR
HNATPVVKASGRELCYILLGGVFLCYCMTFIFIAKPSTAVCTLRRLGLGT
AFSVCYSALLTKTNRIARSPASQVAICLALISGQLLIVVAWLVVEAPGTG
KETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLYAFKTRKCPENF
NEAKFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCVSVSLSGSVVL
GCLFAPKLHIIL
3D structure
PDB8jcw Structural insights into dimerization and activation of the mGlu2-mGlu3 and mGlu2-mGlu4 heterodimers.
Chain2
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 Z99 2 R57 R61 S143 S145 A166 S167 T168 Y216 R271 K377 R34 R38 S102 S104 A125 S126 T127 Y175 R230 K336
BS02 CLR 2 V695 P703 V639 P647
Gene Ontology
Molecular Function
GO:0001641 group II metabotropic glutamate receptor activity
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0004930 G protein-coupled receptor activity
GO:0005160 transforming growth factor beta receptor binding
GO:0005246 calcium channel regulator activity
GO:0005515 protein binding
GO:0005527 macrolide binding
GO:0005528 FK506 binding
GO:0008066 glutamate receptor activity
GO:0016247 channel regulator activity
GO:0030547 signaling receptor inhibitor activity
GO:0034713 type I transforming growth factor beta receptor binding
GO:0044325 transmembrane transporter binding
GO:0070411 I-SMAD binding
GO:0070697 activin receptor binding
GO:0097110 scaffold protein binding
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0003007 heart morphogenesis
GO:0006457 protein folding
GO:0006458 'de novo' protein folding
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007196 adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007216 G protein-coupled glutamate receptor signaling pathway
GO:0007268 chemical synaptic transmission
GO:0010467 gene expression
GO:0014047 glutamate secretion
GO:0014048 regulation of glutamate secretion
GO:0014059 regulation of dopamine secretion
GO:0014809 regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion
GO:0022417 protein maturation by protein folding
GO:0030512 negative regulation of transforming growth factor beta receptor signaling pathway
GO:0032092 positive regulation of protein binding
GO:0032880 regulation of protein localization
GO:0032926 negative regulation of activin receptor signaling pathway
GO:0033554 cellular response to stress
GO:0035095 behavioral response to nicotine
GO:0042026 protein refolding
GO:0042110 T cell activation
GO:0042220 response to cocaine
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0050776 regulation of immune response
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0051966 regulation of synaptic transmission, glutamatergic
GO:0055010 ventricular cardiac muscle tissue morphogenesis
GO:0060292 long-term synaptic depression
GO:0060314 regulation of ryanodine-sensitive calcium-release channel activity
GO:0060347 heart trabecula formation
GO:0070588 calcium ion transmembrane transport
GO:0090461 intracellular glutamate homeostasis
GO:0097435 supramolecular fiber organization
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:1902991 regulation of amyloid precursor protein catabolic process
GO:1990000 amyloid fibril formation
GO:2001023 regulation of response to drug
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014802 terminal cisterna
GO:0016020 membrane
GO:0016529 sarcoplasmic reticulum
GO:0030018 Z disc
GO:0030424 axon
GO:0030425 dendrite
GO:0033017 sarcoplasmic reticulum membrane
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0097449 astrocyte projection
GO:0098562 cytoplasmic side of membrane
GO:0098978 glutamatergic synapse
GO:1990425 ryanodine receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jcw, PDBe:8jcw, PDBj:8jcw
PDBsum8jcw
PubMed37286794
UniProtP62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A (Gene Name=FKBP1A);
Q14416|GRM2_HUMAN Metabotropic glutamate receptor 2 (Gene Name=GRM2)

[Back to BioLiP]