Structure of PDB 8j7a Chain 2

Receptor sequence

>8j7a2 (length=201) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

PDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAEIVHCR
WAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIG
WAEGRRWADIIKPGSVNTDPVFPNNKLTGTDVGYPGGLWFDPLGWGSGSP
AKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHAT
I

3D structure

PDB

8j7a Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)

Chain

Resolution

3.06 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	2	R99 W100 R155 D158 G182 F189	R50 W51 R106 D109 G133 F140
BS02	CLA	2	L103 P111 T122	L54 P62 T73
BS03	CLA	2	G71 F73 F75 L80 N90 V91 E94 R214 M217	G22 F24 F26 L31 N41 V42 E45 R165 M168
BS04	CHL	2	T167 D168 V170 F171 N174 W188	T118 D119 V121 F122 N125 W139
BS05	CHL	2	Y126 E130	Y77 E81
BS06	CLA	2	G222 F225 Q226 T230 N237 T249	G173 F176 Q177 T181 N188 T200
BS07	CLA	2	H241 P245 T249	H192 P196 T200
BS08	CHL	2	I54 W55 F56 P57	I5 W6 F7 P8
BS09	CLA	2	W89 H97	W40 H48
BS10	CHL	2	L140 E144	L91 E95
BS11	CLA	2	K208 K211	K159 K162
BS12	CLA	2	R99 M102 Y183 P184 G185 W194 G195 E209 N212	R50 M53 Y134 P135 G136 W145 G146 E160 N163
BS13	CLA	2	W89 A93 V96 H97 W100 I148 G149 E152 R155 W156	W40 A44 V47 H48 W51 I99 G100 E103 R106 W107
BS14	CLA	2	W150 G153	W101 G104

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0016168	chlorophyll binding
GO:0019904	protein domain specific binding
GO:0046872	metal ion binding

	Biological Process
GO:0009409	response to cold
GO:0009644	response to high light intensity
GO:0009645	response to low light intensity stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0005829	cytosol
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j7a, PDBe:8j7a, PDBj:8j7a
PDBsum	8j7a
PubMed	37936349
UniProt	Q9SYW8\|LHCA2_ARATH Photosystem I chlorophyll a/b-binding protein 2, chloroplastic (Gene Name=LHCA2)

[Back to BioLiP]