Structure of PDB 8j6z Chain 2

Receptor sequence

>8j6z2 (length=201) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

PDRPIWFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAEIVHCR
WAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIG
WAEGRRWADIIKPGSVNTDPVFPNNKLTGTDVGYPGGLWFDPLGWGSGSP
AKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHAT
I

3D structure

PDB

8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)

Chain

Resolution

2.79 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	2	D72 F73 F75 L80 N90 V91 E94 R214 M217	D23 F24 F26 L31 N41 V42 E45 R165 M168
BS02	CLA	2	W89 N90 H97 M221	W40 N41 H48 M172
BS03	CLA	2	L103 G107 P111 T122	L54 G58 P62 T73
BS04	CHL	2	F134 L140 E144	F85 L91 E95
BS05	CHL	2	Y126 E130 F141 E144	Y77 E81 F92 E95
BS06	CHL	2	W55 F56 P57 F73	W6 F7 P8 F24
BS07	CLA	2	K208 K211	K159 K162
BS08	CHL	2	R99 W100 W150 R154 R155 D158 G182 F189	R50 W51 W101 R105 R106 D109 G133 F140
BS09	CLA	2	G222 F225 Q226 T230 N237 I250	G173 F176 Q177 T181 N188 I201
BS10	CLA	2	K208 N212	K159 N163
BS11	CHL	2	R154 T167 D168 V170 F171 N174 L176 W188	R105 T118 D119 V121 F122 N125 L127 W139
BS12	CLA	2	W89 A93 V96 H97 W100 I148 G149 E152 R155 W156	W40 A44 V47 H48 W51 I99 G100 E103 R106 W107
BS13	CLA	2	R99 M102 Y183 P184 G185 F189 D190 L192 W194 G195 L205 N212	R50 M53 Y134 P135 G136 F140 D141 L143 W145 G146 L156 N163
BS14	CLA	2	H241 P245 T249	H192 P196 T200
BS15	CLA	2	W150 G153 R154	W101 G104 R105

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0016168	chlorophyll binding
GO:0019904	protein domain specific binding
GO:0046872	metal ion binding

	Biological Process
GO:0009409	response to cold
GO:0009644	response to high light intensity
GO:0009645	response to low light intensity stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0005829	cytosol
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum	8j6z
PubMed	37936349
UniProt	Q9SYW8\|LHCA2_ARATH Photosystem I chlorophyll a/b-binding protein 2, chloroplastic (Gene Name=LHCA2)

[Back to BioLiP]