Structure of PDB 8d8k Chain 2

Receptor sequence
>8d8k2 (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TIPKPSDQVPDVDAFLNKIGRNCNELKDTFENNWNNLFQWDSKILKEKGV
NIQQRKYILKQVHNYRNNRPIHEIKLGKKSFFGGERKRKAFTAKWKAEN
3D structure
PDB8d8k Principles of mitoribosomal small subunit assembly in eukaryotes.
Chain2
Resolution3.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 R50 S71 K75 I81 Q82 R84 K85 H92 I103 K104 G106 K108 F110 F111 G113 E114 R115 K118 A122 E127 R21 S42 K46 I52 Q53 R55 K56 H63 I74 K75 G77 K79 F81 F82 G84 E85 R86 K89 A93 E98
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d8k, PDBe:8d8k, PDBj:8d8k
PDBsum8d8k
PubMed36482135
UniProtP38783|FYV4_YEAST Small ribosomal subunit protein mS41 (Gene Name=FYV4)

[Back to BioLiP]