Structure of PDB 8c9b Chain 2

Receptor sequence
>8c9b2 (length=35) Species: 562 (Escherichia coli) [Search protein sequence]
LKRNRSHGFRARMATKNGRQVLARRRAKGRARLTV
3D structure
PDB8c9b Cryo-EM captures early ribosome assembly in action.
Chain2
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 L10 N13 R14 H16 F18 R19 M22 R33 R34 R35 K37 G38 R39 A40 L1 N4 R5 H7 F9 R10 M13 R24 R25 R26 K28 G29 R30 A31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c9b, PDBe:8c9b, PDBj:8c9b
PDBsum8c9b
PubMed36797249
UniProtP0A7P5|RL34_ECOLI Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]