Structure of PDB 8c94 Chain 2

Receptor sequence
>8c942 (length=39) Species: 562 (Escherichia coli) [Search protein sequence]
SVLKRNRSHGFRARMATKNGRQVLARRRAKGRARLTVSK
3D structure
PDB8c94 Cryo-EM captures early ribosome assembly in action.
Chain2
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 L10 K11 R12 N13 R14 H16 F18 R19 R21 N26 R28 R34 R35 K37 G38 R39 T43 K46 L3 K4 R5 N6 R7 H9 F11 R12 R14 N19 R21 R27 R28 K30 G31 R32 T36 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c94, PDBe:8c94, PDBj:8c94
PDBsum8c94
PubMed36797249
UniProtP0A7P5|RL34_ECOLI Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]