Structure of PDB 8buu Chain 2

Receptor sequence
>8buu2 (length=44) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
3D structure
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
Chain2
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 K2 R3 T4 F5 Q6 P7 N8 N9 R10 K11 R12 S13 K14 H16 G17 F18 R19 R21 K25 N26 V30 R33 R34 R35 R36 K37 G38 R39 M1 K2 R3 T4 F5 Q6 P7 N8 N9 R10 K11 R12 S13 K14 H16 G17 F18 R19 R21 K25 N26 V30 R33 R34 R35 R36 K37 G38 R39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP05647|RL34_BACSU Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]