Structure of PDB 7yca Chain 2

Receptor sequence

>7yca2 (length=205) Species: 70448 (Ostreococcus tauri) [Search protein sequence]

ERPVWYPGKAPAPHLDGSLPGDFGFDPLSLSADPEMRKWMVQAELQHARW
AMLGVAGAVAPELLTKIGVADLPNWVDAGTYQYWAPAGPLFFIQMAMFNW
AEVRRWQDMKNPGSMNTDPLFGYNSNDTNTDVGYPGGLFDKLGYAKDPAK
AKELKLKEIKNGRLAMVAFLGICAQYVQTGQGPVENLFSHIASPGSVGYF
GSQGL

3D structure

PDB

7yca The photosystem I supercomplex from a primordial green alga Ostreococcus tauri harbors three light-harvesting complex trimers.

Chain

Resolution

2.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CHL	2	V41 W42 Y43 P44 F60	V4 W5 Y6 P7 F23
BS02	CLA	2	L52 G58 D59 F60 F62 D63 L67 S68 M77 V78 A80 E81 H84 R200 M203	L15 G21 D22 F23 F25 D26 L30 S31 M40 V41 A43 E44 H47 R163 M166
BS03	CLA	2	W76 M77 H84	W39 M40 H47
BS04	CLA	2	L90 G94 L109 Y120	L53 G57 L72 Y83
BS05	CHL	2	Y120 L127 Q131 M134 F135	Y83 L90 Q94 M97 F98
BS06	CLA	2	V113 T117 A124 F128 Q131	V76 T80 A87 F91 Q94
BS07	CHL	2	Q83 R86 W87 A138 R141 R142 D145 M152 G170 P172 L175 F176	Q46 R49 W50 A101 R104 R105 D108 M115 G133 P135 L138 F139
BS08	CLA	2	W76 A80 Q83 H84 W87 M132 F135 N136 E139	W39 A43 Q46 H47 W50 M95 F98 N99 E102
BS09	CLA	2	R86 M89 L90 Y171 P172 G173 F176 D177 Y181 A182 L191 K192 E195	R49 M52 L53 Y134 P135 G136 F139 D140 Y144 A145 L154 K155 E158
BS10	CLA	2	E190 K194 K197 N198	E153 K157 K160 N161
BS11	CLA	2	K194 N198	K157 N161
BS12	CLA	2	V204 A205 G208 A211 Q212 Q215 N223 H227 G235 Y236	V167 A168 G171 A174 Q175 Q178 N186 H190 G198 Y199
BS13	CLA	2	H227 I228 P231	H190 I191 P194
BS14	CLA	2	M132 N136 W143	M95 N99 W106
BS15	CHL	2	R141 T154 D155 P156 L157 F158 Y160 L175	R104 T117 D118 P119 L120 F121 Y123 L138
BS16	Q6L	2	M89 F176 D177 L179 Y181 N198 L201 A205 Q212 P220 L224	M52 F139 D140 L142 Y144 N161 L164 A168 Q175 P183 L187
BS17	CHL	2	N136 W137 V140 R141 P156	N99 W100 V103 R104 P119
BS18	CLA	2	Y236 F237	Y199 F200

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7yca, PDBe:7yca, PDBj:7yca
PDBsum	7yca
PubMed	36951548
UniProt	Q3B9U6

[Back to BioLiP]