Structure of PDB 7uvx Chain 2

Receptor sequence
>7uvx2 (length=63) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
AKLKTRRGAAKRFKATANGFKRKQAFKRHILTKKSAKRIRQLRGCVMVHV
SDVASVRRMCPYI
3D structure
PDB7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Chain2
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 A2 K3 L4 K5 T6 R7 R8 K12 R13 A18 N19 K22 R23 F27 R29 H30 L32 T33 K34 R39 R41 R44 Y63 A1 K2 L3 K4 T5 R6 R7 K11 R12 A17 N18 K21 R22 F26 R28 H29 L31 T32 K33 R38 R40 R43 Y62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvx, PDBe:7uvx, PDBj:7uvx
PDBsum7uvx
PubMed37192172
UniProtB7I693|RL35_ACIB5 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]