Structure of PDB 7q0p Chain 2

Receptor sequence

>7q0p2 (length=159) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

GKSRGYRSGTRYAFQRDFKKHGAIPLSTYLKVYKVGDIVDIKANGSIQKG
MPHKYYHGKTGIVYNVTKSSVGVIINKVVGNRYIEKRVNLRVEHVKHSAC
RQEFLNRVKSNAAKKREAKANGETVYLKRQAAKPRGSRIISTEGNIPQTL
APVAYETFI

3D structure

PDB

7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.77 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	2	G2 K3 S4 R5 G6 Y7 R8 S9 G10 R12 Y13 A14 Q16 R17 F19 H22 G23 K35 I39 K43 G46 S47 Q49 K50 G51 H54 K55 Y57 H58 G59 K60 T61 T68 K69 S70 S71 K78 V80 N82 R83 K87 R88 N90 R92 A100 R102 E104 F105 R108 V109 K116 Y127 L128 K129 R130	G1 K2 S3 R4 G5 Y6 R7 S8 G9 R11 Y12 A13 Q15 R16 F18 H21 G22 K34 I38 K42 G45 S46 Q48 K49 G50 H53 K54 Y56 H57 G58 K59 T60 T67 K68 S69 S70 K77 V79 N81 R82 K86 R87 N89 R91 A99 R101 E103 F104 R107 V108 K115 Y126 L127 K128 R129
BS02	rna	2	P26 S28	P25 S27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum	7q0p
PubMed	35613268
UniProt	A0A1D8PGY0\|RL21A_CANAL Large ribosomal subunit protein eL21 (Gene Name=RPL21A)

[Back to BioLiP]