Structure of PDB 7pnw Chain 2

Receptor sequence
>7pnw2 (length=117) Species: 10090 (Mus musculus) [Search protein sequence]
ATPSLRGRLARFANPGKPILKPNKPLILANRVGNRRREKGEATCITEMSM
MMACWKQNEFRDEACRKEIQDFFDCSSRAQEARKMRSIQESLGQSESLSP
HKMTKLLQRFPNKSHLI
3D structure
PDB7pnw Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
Chain2
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 S5 R9 A11 R12 F13 K18 P19 I20 K22 N24 K25 R32 G34 R36 R37 R38 E39 K40 R84 M104 K106 Q109 R110 S4 R8 A10 R11 F12 K17 P18 I19 K21 N23 K24 R31 G33 R35 R36 R37 E38 K39 R83 M103 K105 Q108 R109
Gene Ontology
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnw, PDBe:7pnw, PDBj:7pnw
PDBsum7pnw
PubMed35676484
UniProtQ9CQA6|CHCH1_MOUSE Small ribosomal subunit protein mS37 (Gene Name=Chchd1)

[Back to BioLiP]