Structure of PDB 7pib Chain 2

Receptor sequence
>7pib2 (length=37) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKVRASVKPICKDCKIIKRHQIVRVICKTQKHKQRQG
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chain2
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 V3 R4 A5 S6 V7 K12 K18 R19 H20 R24 K31 K33 R35 G37 M1 V3 R4 A5 S6 V7 K12 K18 R19 H20 R24 K31 K33 R35 G37
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP52864|RL36_MYCPN Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]