Structure of PDB 7pi9 Chain 2

Receptor sequence
>7pi92 (length=37) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKVRASVKPICKDCKIIKRHQIVRVICKTQKHKQRQG
3D structure
PDB7pi9 Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chain2
Resolution6.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 M1 K2 R4 A5 S6 K8 I10 K12 K15 R19 H20 Q21 R24 Q30 K31 R35 Q36 M1 K2 R4 A5 S6 K8 I10 K12 K15 R19 H20 Q21 R24 Q30 K31 R35 Q36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pi9, PDBe:7pi9, PDBj:7pi9
PDBsum7pi9
PubMed36171285
UniProtP52864|RL36_MYCPN Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]