Structure of PDB 7p7r Chain 2

Receptor sequence
>7p7r2 (length=57) Species: 226185 (Enterococcus faecalis V583) [Search protein sequence]
AELKITLKRSVIGRPQNQRATVKALGLGKVNSTVTKPANEAIKGMVNTIS
HLVDVEE
3D structure
PDB7p7r Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chain2
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 R10 S11 I13 G14 A21 T22 A25 K30 V31 N32 K37 N40 A42 I43 G45 M46 R9 S10 I12 G13 A20 T21 A24 K29 V30 N31 K36 N39 A41 I42 G44 M45
BS02 rna 2 Q19 H52 Q18 H51
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7r, PDBe:7p7r, PDBj:7p7r
PDBsum7p7r
PubMed35387982
UniProtQ839E6|RL30_ENTFA Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]