Structure of PDB 7of6 Chain 2

Receptor sequence
>7of62 (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]
ARGNEYQPSNIKRKNKHGWVRRLSTPAGVQVILRRMLKGRKSLSH
3D structure
PDB7of6 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
Chain2
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 2 A48 R49 G50 N51 E52 Y53 Q54 P55 S56 N57 I58 K59 R60 K61 N62 K63 H64 G65 W66 V67 R69 A74 V78 R81 R82 K85 G86 R87 K88 H92 A1 R2 G3 N4 E5 Y6 Q7 P8 S9 N10 I11 K12 R13 K14 N15 K16 H17 G18 W19 V20 R22 A27 V31 R34 R35 K38 G39 R40 K41 H45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of6, PDBe:7of6, PDBj:7of6
PDBsum7of6
PubMed34135319
UniProtQ9BQ48|RM34_HUMAN Large ribosomal subunit protein bL34m (Gene Name=MRPL34)

[Back to BioLiP]